Anti-CFAP57, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CFAP57, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002736
• Supplier Catalog Number: HPA002736
• Alternative Catalog Number: ATA-HPA002736-25,ATA-HPA002736-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ32000, WDR65

Product Description

cilia and flagella associated protein 57

Additional Information

Anti-CFAP57

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 149465
• UniProt: Q96MR6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGNGMFKLLRFAEGTLKQTSFQRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CFAP57
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP57 antibody. Corresponding CFAP57 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human fallopian tube, liver, lymph node and prostate using Anti-CFAP57 antibody HPA002736 (A) shows similar protein distribution across tissues to independent antibody HPA028623 (B).

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human prostate shows low expression as expected.

Immunohistochemical staining of human liver using Anti-CFAP57 antibody HPA002736.

Immunohistochemical staining of human lymph node using Anti-CFAP57 antibody HPA002736.

HPA002736

HPA002736

HPA002736