Anti-CSPG4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CSPG4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA002951
• Supplier Catalog Number: HPA002951
• Alternative Catalog Number: ATA-HPA002951-25,ATA-HPA002951-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2

Product Description

chondroitin sulfate proteoglycan 4

Additional Information

Anti-CSPG4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1464
• UniProt: Q6UVK1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CSPG4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.

Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.

Western blot analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419670).

HPA002951

HPA002951

HPA002951