Anti-BNIP3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003015
- Images (9)
| Article Name: | Anti-BNIP3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003015 |
| Supplier Catalog Number: | HPA003015 |
| Alternative Catalog Number: | ATA-HPA003015-25,ATA-HPA003015-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Nip3 |
| BCL2/adenovirus E1B 19kDa interacting protein 3 |
| Anti-BNIP3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 664 |
| UniProt: | Q12983 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BNIP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
HPA003015 |
|
|
|
|
|
HPA003015 |
|
|
HPA003015 |
Product Guarantee and Expert Support
