Anti-MDP1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003064
- Images (9)
| Article Name: | Anti-MDP1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003064 |
| Supplier Catalog Number: | HPA003064 |
| Alternative Catalog Number: | ATA-HPA003064-25,ATA-HPA003064-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FN6Pase, MGC5987 |
| magnesium-dependent phosphatase 1 |
| Anti-MDP1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 145553 |
| UniProt: | Q86V88 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MDP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-MDP1 antibody. Corresponding MDP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA003064 |
|
|
|
|
|
|
|
|
HPA003064 |
|
|
HPA003064 |
Product Guarantee and Expert Support
