Anti-ZAP70, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003134
- Images (8)
| Article Name: | Anti-ZAP70, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003134 |
| Supplier Catalog Number: | HPA003134 |
| Alternative Catalog Number: | ATA-HPA003134-25,ATA-HPA003134-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SRK, STD, ZAP-70, Pan-Cancer |
| zeta-chain (TCR) associated protein kinase 70kDa |
| Anti-ZAP70 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7535 |
| UniProt: | P43403 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LIYCLKEACPNSSASSGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZAP70 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-ZAP70 antibody. Corresponding ZAP70 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA003134 |
|
|
|
|
|
HPA003134 |
|
|
HPA003134 |
Product Guarantee and Expert Support
