Anti-SLC6A14 Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SLC6A14 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA003193
• Supplier Catalog Number: HPA003193
• Alternative Catalog Number: ATA-HPA003193-100,ATA-HPA003193-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SLC6A14

Product Description

solute carrier family 6 (amino acid transporter), member 14

Additional Information

Anti-SLC6A14

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 11254
• UniProt: Q9UN76
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC6A14
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.

Immunohistochemistry analysis in human lung and liver tissues using HPA003193 antibody. Corresponding SLC6A14 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.

Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.

Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected.

Immunohistochemical staining of human lung shows strong membranous positivity in macrophages.

HPA003193

HPA003193

HPA003193