Anti-SLC6A14, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003193
- Images (9)
| Article Name: | Anti-SLC6A14, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003193 |
| Supplier Catalog Number: | HPA003193 |
| Alternative Catalog Number: | ATA-HPA003193-25,ATA-HPA003193-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SLC6A14 |
| solute carrier family 6 (amino acid transporter), member 14 |
| Anti-SLC6A14 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 11254 |
| UniProt: | Q9UN76 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC6A14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human lung and liver tissues using HPA003193 antibody. Corresponding SLC6A14 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no membranous positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human lung shows strong membranous positivity in macrophages. |
|
|
HPA003193 |
|
|
HPA003193 |
|
|
HPA003193 |
Product Guarantee and Expert Support
