Anti-OLIG2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003254
- Images (9)
| Article Name: | Anti-OLIG2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003254 |
| Supplier Catalog Number: | HPA003254 |
| Alternative Catalog Number: | ATA-HPA003254-25,ATA-HPA003254-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BHLHB1, bHLHe19, OLIGO2, PRKCBP2, RACK17 |
| oligodendrocyte lineage transcription factor 2 |
| Anti-OLIG2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 10215 |
| UniProt: | Q13516 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | OLIG2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells. |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA003254 antibody. Corresponding OLIG2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in oligodendrocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity as expected. |
|
|
Western blot analysis in human cerebral cortex tissue. |
|
|
HPA003254 |
|
|
|
|
|
HPA003254 |
|
|
HPA003254 |
Product Guarantee and Expert Support
