Anti-MEIS2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003256
- Images (9)
| Article Name: | Anti-MEIS2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003256 |
| Supplier Catalog Number: | HPA003256 |
| Alternative Catalog Number: | ATA-HPA003256-25,ATA-HPA003256-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HsT18361, MRG1 |
| Meis homeobox 2 |
| Anti-MEIS2 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 4212 |
| UniProt: | O14770 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MEIS2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human liver shows low positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular and smooth muscle cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons. |
|
|
HPA003256 |
|
|
|
|
|
HPA003256 |
|
|
HPA003256 |
Product Guarantee and Expert Support
