Anti-MITF, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MITF, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA003259
• Supplier Catalog Number: HPA003259
• Alternative Catalog Number: ATA-HPA003259-25,ATA-HPA003259-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bHLHe32, MI, WS2, WS2A

Product Description

microphthalmia-associated transcription factor

Additional Information

Anti-MITF

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 4286
• UniProt: O75030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MITF
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.

Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in melanocytes.

Immunohistochemical staining of human pancreas shows no positivity as expected.

Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MITF antibody. Corresponding MITF RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Western blot analysis in control (vector only transfected HEK293T lysate) and MITF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404987).

HPA003259

HPA003259

HPA003259