Anti-ZEB2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003456
- Images (9)
| Article Name: | Anti-ZEB2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003456 |
| Supplier Catalog Number: | HPA003456 |
| Alternative Catalog Number: | ATA-HPA003456-25,ATA-HPA003456-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0569, SIP-1, SIP1, ZFHX1B |
| zinc finger E-box binding homeobox 2 |
| Anti-ZEB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9839 |
| UniProt: | O60315 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZEB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells. |
|
|
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
HPA003456 |
|
|
|
|
|
HPA003456 |
|
|
HPA003456 |
Product Guarantee and Expert Support
