Anti-RPLP0, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003512
- Images (9)
| Article Name: | Anti-RPLP0, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003512 |
| Supplier Catalog Number: | HPA003512 |
| Alternative Catalog Number: | ATA-HPA003512-25,ATA-HPA003512-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | L10E, LP0, P0, PRLP0, RPP0 |
| ribosomal protein, large, P0 |
| Anti-RPLP0 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 6175 |
| UniProt: | P05388 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPLP0 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
|
|
|
HPA003512 |
|
|
HPA003512 |
|
|
HPA003512 |
Product Guarantee and Expert Support
