Anti-FCGBP, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003564
- Images (9)
| Article Name: | Anti-FCGBP, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003564 |
| Supplier Catalog Number: | HPA003564 |
| Alternative Catalog Number: | ATA-HPA003564-25,ATA-HPA003564-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FC(GAMMA)BP |
| Fc fragment of IgG binding protein |
| Anti-FCGBP |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8857 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FCGBP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-FCGBP antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-FCGBP antibody HPA003564 (A) shows similar protein distribution across tissues to independent antibody HPA003517 (B). |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-FCGBP antibody HPA003564. |
|
|
Immunohistochemical staining of human kidney using Anti-FCGBP antibody HPA003564. |
|
|
HPA003564 |
|
|
HPA003564 |
|
|
HPA003564 |
Product Guarantee and Expert Support
