Anti-TRIM22, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003575
- Images (9)
| Article Name: | Anti-TRIM22, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003575 |
| Supplier Catalog Number: | HPA003575 |
| Alternative Catalog Number: | ATA-HPA003575-25,ATA-HPA003575-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GPSTAF50, RNF94, STAF50 |
| tripartite motif containing 22 |
| Anti-TRIM22 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 10346 |
| UniProt: | Q8IYM9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRIM22 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line ASC TERT1 shows localization to nucleoplasm, nuclear bodies & the Golgi apparatus. |
|
|
Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TRIM22 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
|
|
|
|
|
|
|
HPA003575 |
|
|
HPA003575 |
|
|
HPA003575 |
Product Guarantee and Expert Support
