Anti-F13B, Rabbit, Polyclonal
Catalog Number:
ATA-HPA003827
- Images (9)
| Article Name: | Anti-F13B, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA003827 |
| Supplier Catalog Number: | HPA003827 |
| Alternative Catalog Number: | ATA-HPA003827-25,ATA-HPA003827-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FXIIIB |
| coagulation factor XIII, B polypeptide |
| Anti-F13B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2165 |
| UniProt: | P05160 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | F13B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows positivity in plasma in blood vessels. |
|
|
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows positivity in plasma. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
|
|
|
HPA003827 |
|
|
HPA003827 |
|
|
HPA003827 |
Product Guarantee and Expert Support
