Anti-SMARCD1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004101
- Images (9)
| Article Name: | Anti-SMARCD1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004101 |
| Supplier Catalog Number: | HPA004101 |
| Alternative Catalog Number: | ATA-HPA004101-25,ATA-HPA004101-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BAF60A, CRACD1, Rsc6p |
| SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 |
| Anti-SMARCD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6602 |
| UniProt: | Q96GM5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMARCD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA004101 |
|
|
|
|
|
|
|
|
HPA004101 |
|
|
HPA004101 |
Product Guarantee and Expert Support
