Anti-LRP1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-LRP1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA004182
• Supplier Catalog Number: HPA004182
• Alternative Catalog Number: ATA-HPA004182-25,ATA-HPA004182-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: A2MR, APOER, APR, CD91, LRP, LRP1A, Pan-Cancer

Product Description

low density lipoprotein receptor-related protein 1

Additional Information

Anti-LRP1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 4035
• UniProt: Q07954
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: LRP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & vesicles.

Immunohistochemical staining of human hippocampus shows mdrate cytoplasmic positivity in neuronal cells.

HPA004182

HPA004182

HPA004182