Anti-KIT, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004471
- Images (6)
| Article Name: | Anti-KIT, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004471 |
| Supplier Catalog Number: | HPA004471 |
| Alternative Catalog Number: | ATA-HPA004471-25,ATA-HPA004471-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C-Kit, CD117, PBT, SCFR, Pan-Cancer |
| v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog |
| Anti-KIT |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3815 |
| UniProt: | P10721 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KIT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human breast and prostate tissues using Anti-KIT antibody. Corresponding KIT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human breast shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA004471 |
|
|
HPA004471 |
|
|
HPA004471 |
Product Guarantee and Expert Support
