Anti-PGR, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004751
- Images (9)
| Article Name: | Anti-PGR, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004751 |
| Supplier Catalog Number: | HPA004751 |
| Alternative Catalog Number: | ATA-HPA004751-25,ATA-HPA004751-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NR3C3, PR, Pan-Cancer |
| progesterone receptor |
| Anti-PGR |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 5241 |
| UniProt: | P06401 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PGR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA004751 (A) shows similar protein distribution across tissues to independent antibody HPA008428 (B). |
|
|
Immunohistochemical staining of human endometrium shows high expression. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA004751. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA004751. |
|
|
HPA004751 |
|
|
HPA004751 |
|
|
HPA004751 |
Product Guarantee and Expert Support
