Anti-IRF3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004895
- Images (9)
| Article Name: | Anti-IRF3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004895 |
| Supplier Catalog Number: | HPA004895 |
| Alternative Catalog Number: | ATA-HPA004895-25,ATA-HPA004895-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IRF3 |
| interferon regulatory factor 3 |
| Anti-IRF3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3661 |
| UniProt: | Q14653 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IRF3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IRF3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line A-549. |
|
|
HPA004895 |
|
|
|
|
|
|
|
|
HPA004895 |
|
|
HPA004895 |
Product Guarantee and Expert Support
