Anti-BCL6, Rabbit, Polyclonal

Catalog Number: ATA-HPA004899
Article Name: Anti-BCL6, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004899
Supplier Catalog Number: HPA004899
Alternative Catalog Number: ATA-HPA004899-25,ATA-HPA004899-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
B-cell CLL/lymphoma 6
Anti-BCL6
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 604
UniProt: P41182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARPYFPCDKASKEEERPSSEDEIALHFEPPPLNRKGLVSPQSPQKSDCQPNSPTESCSSKCILQASGSPPAKSPTDPKACNWKKYKFIVLNS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BCL6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA004899 antibody. Corresponding BCL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemical staining of human pancreas shows no positivity as expected.
HPA004899
HPA004899
HPA004899