Anti-HTR1E, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004931
- Images (9)
| Article Name: | Anti-HTR1E, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004931 |
| Supplier Catalog Number: | HPA004931 |
| Alternative Catalog Number: | ATA-HPA004931-25,ATA-HPA004931-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 5-HT1E |
| 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled |
| Anti-HTR1E |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3354 |
| UniProt: | P28566 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HTR1E |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human testis shows moderate membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil. |
|
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424479). |
|
|
|
|
|
HPA004931 |
|
|
HPA004931 |
|
|
HPA004931 |
Product Guarantee and Expert Support
