Anti-SLCO1B3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004943
- Images (9)
| Article Name: | Anti-SLCO1B3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004943 |
| Supplier Catalog Number: | HPA004943 |
| Alternative Catalog Number: | ATA-HPA004943-25,ATA-HPA004943-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OATP1B3, OATP8, SLC21A8 |
| solute carrier organic anion transporter family, member 1B3 |
| Anti-SLCO1B3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 28234 |
| UniProt: | Q9NPD5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDAA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLCO1B3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemistry analysis in human liver and kidney tissues using Anti-SLCO1B3 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLCO1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412714). |
|
|
|
|
|
HPA004943 |
|
|
HPA004943 |
|
|
HPA004943 |
Product Guarantee and Expert Support
