Anti-SEC31A, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SEC31A, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA005457
• Supplier Catalog Number: HPA005457
• Alternative Catalog Number: ATA-HPA005457-25,ATA-HPA005457-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ABP125, ABP130, KIAA0905, SEC31L1

Product Description

SEC31 homolog A (S. cerevisiae)

Additional Information

Anti-SEC31A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 22872
• UniProt: O94979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SEC31A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.

Immunohistochemical staining of human endometrium shows positivit in glandular cells.

Immunohistochemical staining of human cerebral cortex shows positivity in neurons.

Immunohistochemical staining of human liver shows positivity in hepatocytes.

Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.

HPA005457

HPA005457

HPA005457