Anti-SNCA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005459
- Images (9)
| Article Name: | Anti-SNCA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005459 |
| Supplier Catalog Number: | HPA005459 |
| Alternative Catalog Number: | ATA-HPA005459-25,ATA-HPA005459-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | alpha-synuclein, NACP, PARK1, PARK4, PD1 |
| synuclein, alpha (non A4 component of amyloid precursor) |
| Anti-SNCA |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6622 |
| UniProt: | P37840 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SNCA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
|
HPA005459 |
|
|
|
|
|
HPA005459 |
|
|
HPA005459 |
Product Guarantee and Expert Support
