Anti-ASAH1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ASAH1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA005468
• Supplier Catalog Number: HPA005468
• Alternative Catalog Number: ATA-HPA005468-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: AC, ASAH, FLJ21558, PHP32

Product Description

N-acylsphingosine amidohydrolase (acid ceramidase) 1

Additional Information

Anti-ASAH1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 427
• UniProt: Q13510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ASAH1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.

Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

HPA005468

HPA005468

HPA005468