Anti-ANXA10, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005469
- Images (9)
| Article Name: | Anti-ANXA10, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005469 |
| Supplier Catalog Number: | HPA005469 |
| Alternative Catalog Number: | ATA-HPA005469-25,ATA-HPA005469-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANX14 |
| annexin A10 |
| Anti-ANXA10 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 11199 |
| UniProt: | Q9UJ72 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ANXA10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and tonsil tissues using HPA005469 antibody. Corresponding ANXA10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate nuclear positivity in urothelial cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells. |
|
|
Western blot analysis in human stomach tissue. |
|
|
|
|
|
HPA005469 |
|
|
HPA005469 |
|
|
HPA005469 |
Product Guarantee and Expert Support
