Anti-KEAP1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005558
- Images (9)
| Article Name: | Anti-KEAP1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005558 |
| Supplier Catalog Number: | HPA005558 |
| Alternative Catalog Number: | ATA-HPA005558-25,ATA-HPA005558-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454 |
| kelch-like ECH-associated protein 1 |
| Anti-KEAP1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 9817 |
| UniProt: | Q14145 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KEAP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes. |
|
|
HPA005558 |
|
|
|
|
|
HPA005558 |
|
|
HPA005558 |
Product Guarantee and Expert Support
