Anti-PDZK1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005755
- Images (9)
| Article Name: | Anti-PDZK1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005755 |
| Supplier Catalog Number: | HPA005755 |
| Alternative Catalog Number: | ATA-HPA005755-25,ATA-HPA005755-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NHERF3, PDZD1 |
| PDZ domain containing 1 |
| Anti-PDZK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5174 |
| UniProt: | Q5T2W1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVET |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PDZK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-PDZK1 antibody. Corresponding PDZK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis in human cell line TD47D. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and PDZK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400926). |
|
|
HPA005755 |
|
|
|
|
|
HPA005755 |
|
|
HPA005755 |
Product Guarantee and Expert Support
