Anti-PCP4, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005792
- Images (9)
| Article Name: | Anti-PCP4, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005792 |
| Supplier Catalog Number: | HPA005792 |
| Alternative Catalog Number: | ATA-HPA005792-25,ATA-HPA005792-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PEP-19 |
| Purkinje cell protein 4 |
| Anti-PCP4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5121 |
| UniProt: | P48539 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PCP4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005792 antibody. Corresponding PCP4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity. |
|
|
Immunofluorescence staining of mouse cerebral cortex shows strong positivity in the deep layers neurons. |
|
|
Immunofluorescence staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
HPA005792 |
|
|
HPA005792 |
|
|
HPA005792 |
Product Guarantee and Expert Support
