Anti-CLIC3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CLIC3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA005963
• Supplier Catalog Number: HPA005963
• Alternative Catalog Number: ATA-HPA005963-25,ATA-HPA005963-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CLIC3

Product Description

chloride intracellular channel 3

Additional Information

Anti-CLIC3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 9022
• UniProt: O95833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CLIC3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.

Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human esophagus shows high expression.

Immunohistochemical staining of human cerebral cortex shows low expression as expected.

Western blot analysis in human cell lines MCF-7 and A-549 using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MCF-7

HPA005963

HPA005963