Anti-HMBS, Rabbit, Polyclonal
Catalog Number:
ATA-HPA006114
- Images (9)
| Article Name: | Anti-HMBS, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA006114 |
| Supplier Catalog Number: | HPA006114 |
| Alternative Catalog Number: | ATA-HPA006114-25,ATA-HPA006114-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PBGD, PORC, UPS |
| hydroxymethylbilane synthase |
| Anti-HMBS |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 3145 |
| UniProt: | P08397 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HMBS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA006114 |
|
|
|
|
|
HPA006114 |
|
|
HPA006114 |
Product Guarantee and Expert Support
