Anti-ADNP, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ADNP, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA006371
• Supplier Catalog Number: HPA006371
• Alternative Catalog Number: ATA-HPA006371-25,ATA-HPA006371-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ADNP1, KIAA0784

Product Description

activity-dependent neuroprotector homeobox

Additional Information

Anti-ADNP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 23394
• UniProt: Q9H2P0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHSDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ADNP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemical staining of human stomach shows strong nuclear and moderate cytoplasmic positivity in glandular cells.

Western blot analysis in human cell line SH-SY5Y.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA006371

HPA006371

HPA006371