Anti-RBM14, Rabbit, Polyclonal
Catalog Number:
ATA-HPA006628
- Images (9)
| Article Name: | Anti-RBM14, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA006628 |
| Supplier Catalog Number: | HPA006628 |
| Alternative Catalog Number: | ATA-HPA006628-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | COAA, DKFZp779J0927, SIP, SYTIP1 |
| RNA binding motif protein 14 |
| Anti-RBM14 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10432 |
| UniProt: | Q96PK6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TQSSASLAASYAAQQHPQAAASYRGQPGYDGAGQPSAAYLSMSQGAVANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RBM14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in both neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA006628 |
|
|
|
|
|
|
|
|
HPA006628 |
|
|
HPA006628 |
Product Guarantee and Expert Support
