Anti-SCG3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA006880
- Images (9)
| Article Name: | Anti-SCG3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA006880 |
| Supplier Catalog Number: | HPA006880 |
| Alternative Catalog Number: | ATA-HPA006880-25,ATA-HPA006880-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ90833, SGIII |
| secretogranin III |
| Anti-SCG3 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 29106 |
| UniProt: | Q8WXD2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SCG3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and placenta tissues using Anti-SCG3 antibody. Corresponding SCG3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SCG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402232). |
|
|
HPA006880 |
|
|
|
|
|
HPA006880 |
|
|
HPA006880 |
Product Guarantee and Expert Support
