Anti-TP63, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TP63, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007010
• Supplier Catalog Number: HPA007010
• Alternative Catalog Number: ATA-HPA007010-25,ATA-HPA007010-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L, Pan-Cancer

Product Description

tumor protein p63

Additional Information

Anti-TP63

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 8626
• UniProt: Q9H3D4
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TP63
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry analysis in human skin and pancreas tissues using HPA007010 antibody. Corresponding TP63 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows weak nuclear positivity in basal layer of glandular cells.

Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemical staining of human skin shows strong nuclear positivity in keratinocytes.

HPA007010

HPA007010

HPA007010