Anti-CD81, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CD81, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007234
• Supplier Catalog Number: HPA007234
• Alternative Catalog Number: ATA-HPA007234-25,ATA-HPA007234-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: TAPA-1, TAPA1, TSPAN28, Pan-Cancer

Product Description

CD81 molecule

Additional Information

Anti-CD81

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 975
• UniProt: P60033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CD81
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA007234 antibody. Corresponding CD81 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

HPA007234

HPA007234

HPA007234