Anti-MUC1, Rabbit, Polyclonal

Catalog Number: ATA-HPA007235
Article Name: Anti-MUC1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007235
Supplier Catalog Number: HPA007235
Alternative Catalog Number: ATA-HPA007235-25,ATA-HPA007235-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADMCKD, ADMCKD1, CD227, MCD, MCKD, MCKD1, PEM, PUM, Pan-Cancer
mucin 1, cell surface associated
Anti-MUC1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4582
UniProt: P15941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TPGGEKETSATQRSSVPSSTEKFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MUC1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemical staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
HPA007235