Anti-IL1RL1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA007406
- Images (9)
| Article Name: | Anti-IL1RL1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA007406 |
| Supplier Catalog Number: | HPA007406 |
| Alternative Catalog Number: | ATA-HPA007406-25,ATA-HPA007406-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1 |
| interleukin 1 receptor-like 1 |
| Anti-IL1RL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9173 |
| UniProt: | Q01638 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IL1RL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes. |
|
|
Western blot analysis in human cell line HEL. |
|
|
HPA007406 |
|
|
|
|
|
HPA007406 |
|
|
HPA007406 |
Product Guarantee and Expert Support
