Anti-COL3A1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA007583
- Images (9)
| Article Name: | Anti-COL3A1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA007583 |
| Supplier Catalog Number: | HPA007583 |
| Alternative Catalog Number: | ATA-HPA007583-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EDS4A |
| collagen, type III, alpha 1 |
| Anti-COL3A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1281 |
| UniProt: | P02461 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COL3A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in stromal cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in fibroblasts. |
|
|
Immunohistochemical staining of human colorectal cancer shows weak to moderate cytoplasmic positivity in stromal cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-COL3A1 antibody. Corresponding COL3A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
|
|
|
HPA007583 |
|
|
HPA007583 |
|
|
HPA007583 |
Product Guarantee and Expert Support
