Anti-RIOX2, Rabbit, Polyclonal

Catalog Number: ATA-HPA007603
Article Name: Anti-RIOX2, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007603
Supplier Catalog Number: HPA007603
Alternative Catalog Number: ATA-HPA007603-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ14393, JMJD10, mdig, MINA, MINA53, NO52
ribosomal oxygenase 2
Anti-RIOX2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 84864
UniProt: Q8IUF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RIOX2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemical staining of human thyroid gland shows nuclear positivity in glandular cells.
Western blot analysis in human cell lines A-431 and HeLa using Anti-RIOX2 antibody. Corresponding RIOX2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and MINA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407126).
HPA007603
HPA007603
HPA007603