Anti-PRDX1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA007730
- Images (9)
| Article Name: | Anti-PRDX1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA007730 |
| Supplier Catalog Number: | HPA007730 |
| Alternative Catalog Number: | ATA-HPA007730-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NKEFA, PAGA |
| peroxiredoxin 1 |
| Anti-PRDX1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5052 |
| UniProt: | Q06830 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRDX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PRDX1 antibody. Corresponding PRDX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line HepG2. |
|
|
HPA007730 |
|
|
|
|
|
|
|
|
HPA007730 |
|
|
HPA007730 |
Product Guarantee and Expert Support
