Anti-CDK7, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CDK7, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007932
• Supplier Catalog Number: HPA007932
• Alternative Catalog Number: ATA-HPA007932-25,ATA-HPA007932-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CAK, CAK1, CDKN7, MO15, STK1

Product Description

cyclin-dependent kinase 7

Additional Information

Anti-CDK7

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 1022
• UniProt: P50613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CDK7
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human gallbladder and liver tissues using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human gallbladder shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Western blot analysis in control (vector only transfected HEK293T lysate) and CDK7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419742).

HPA007932

HPA007932

HPA007932