Anti-VSIR, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-VSIR, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007968
• Supplier Catalog Number: HPA007968
• Alternative Catalog Number: ATA-HPA007968-25,ATA-HPA007968-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA

Product Description

V-set immunoregulatory receptor

Additional Information

Anti-VSIR

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 64115
• UniProt: Q9H7M9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: VSIR
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in a subset of lymphoid cells.

Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in leukocytes.

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in leukocytes.

Western blot analysis in human cell lines A-431 and HEK293 using Anti-VSIR antibody. Corresponding VSIR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Western blot analysis in control (vector only transfected HEK293T lysate) and C10orf54 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411741).

HPA007968

HPA007968

HPA007968