Anti-CEL, Rabbit, Polyclonal
Catalog Number:
ATA-HPA008023
- Images (9)
| Article Name: | Anti-CEL, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA008023 |
| Supplier Catalog Number: | HPA008023 |
| Alternative Catalog Number: | ATA-HPA008023-25,ATA-HPA008023-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BSSL, MODY8 |
| carboxyl ester lipase |
| Anti-CEL |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1056 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CEL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CEL antibody. Corresponding CEL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human breast, cerebral cortex, liver and pancreas using Anti-CEL antibody HPA008023 (A) shows similar protein distribution across tissues to independent antibody HPA052701 (B). |
|
|
Immunohistochemical staining of human pancreas shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CEL antibody HPA008023. |
|
|
Immunohistochemical staining of human breast using Anti-CEL antibody HPA008023. |
|
|
HPA008023 |
|
|
HPA008023 |
|
|
HPA008023 |
Product Guarantee and Expert Support
