Anti-RET, Rabbit, Polyclonal
Catalog Number:
ATA-HPA008356
- Images (9)
| Article Name: | Anti-RET, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA008356 |
| Supplier Catalog Number: | HPA008356 |
| Alternative Catalog Number: | ATA-HPA008356-25,ATA-HPA008356-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET51, Pan-Cancer |
| ret proto-oncogene |
| Anti-RET |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 5979 |
| UniProt: | P07949 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKESPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RET |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles. |
|
|
Immunohistochemical staining of human gastrointestinal shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
|
HPA008356 |
|
|
|
|
|
HPA008356 |
|
|
HPA008356 |
Product Guarantee and Expert Support
