Anti-QPCT, Rabbit, Polyclonal
Catalog Number:
ATA-HPA008406
- Images (9)
| Article Name: | Anti-QPCT, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA008406 |
| Supplier Catalog Number: | HPA008406 |
| Alternative Catalog Number: | ATA-HPA008406-25,ATA-HPA008406-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GCT, QC |
| glutaminyl-peptide cyclotransferase |
| Anti-QPCT |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 25797 |
| UniProt: | Q16769 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | QPCT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Western blot analysis in human cell line SK-MEL-30. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415772). |
|
|
HPA008406 |
|
|
|
|
|
HPA008406 |
|
|
HPA008406 |
Product Guarantee and Expert Support
