Anti-NME1, Rabbit, Polyclonal

Catalog Number: ATA-HPA008467
Article Name: Anti-NME1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA008467
Supplier Catalog Number: HPA008467
Alternative Catalog Number: ATA-HPA008467-25,ATA-HPA008467-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NDPKA, NM23, NM23-H1
NME/NM23 nucleoside diphosphate kinase 1
Anti-NME1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 4830
UniProt: P15531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NME1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA008467
HPA008467
HPA008467