Anti-IGDCC4, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IGDCC4, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA008576
• Supplier Catalog Number: HPA008576
• Alternative Catalog Number: ATA-HPA008576-25,ATA-HPA008576-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: LOC57722, NOPE

Product Description

immunoglobulin superfamily, DCC subclass, member 4

Additional Information

Anti-IGDCC4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 57722
• UniProt: Q8TDY8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IGDCC4
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.

Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells.

Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.

HPA008576

HPA008576

HPA008576