Anti-ITGB2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA008877
- Images (11)
| Article Name: | Anti-ITGB2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA008877 |
| Supplier Catalog Number: | HPA008877 |
| Alternative Catalog Number: | ATA-HPA008877-25,ATA-HPA008877-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD18, LFA-1, MAC-1, MFI7, Pan-Cancer |
| integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) |
| Anti-ITGB2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3689 |
| UniProt: | P05107 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ITGB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-ITGB2 antibody. Corresponding ITGB2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, lymph node, skeletal muscle and spleen using Anti-ITGB2 antibody HPA008877 (A) shows similar protein distribution across tissues to independent antibody HPA016894 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-ITGB2 antibody HPA008877. |
|
|
Immunohistochemical staining of human bone marrow using Anti-ITGB2 antibody HPA008877. |
|
|
Western blot analysis using Anti-ITGB2 antibody HPA008877 (A) shows similar pattern to independent antibody HPA016894 (B). |
|
|
HPA008877 |
|
|
|
|
|
HPA008877 |
|
|
HPA008877 |
Product Guarantee and Expert Support
