Anti-RMDN3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RMDN3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA009975
• Supplier Catalog Number: HPA009975
• Alternative Catalog Number: ATA-HPA009975-25,ATA-HPA009975-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3

Product Description

regulator of microtubule dynamics 3

Additional Information

Anti-RMDN3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 55177
• UniProt: Q96TC7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RMDN3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.

Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Western blot analysis in human cell line CACO-2.

HPA009975

HPA009975

HPA009975